Lineage for d2e20a2 (2e20 A:193-397)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.2: Acetokinase-like [53080] (4 proteins) 
Protein Propionate kinase [142462] (1 species) Species Salmonella typhimurium [TaxId:90371] [142463] (12 PDB entries)
Uniprot O06961 193-397! Uniprot O06961 4-192
Domain d2e20a2: 2e20 A:193-397 [146634]
automated match to d1x3ma1
complexed with b4p, edo
Details for d2e20a2
PDB Entry: 2e20 (more details), 2.4 Å
PDB Description: crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a)
PDB Compounds: (A:) Propionate kinaseSCOPe Domain Sequences for d2e20a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e20a2 c.55.1.2 (A:193-397) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka
SCOPe Domain Coordinates for d2e20a2:
Click to download the PDB-style file with coordinates for d2e20a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2e20a2:
- d2e20a2 first appeared in SCOP 1.75
- d2e20a2 appears in SCOPe 2.07
View in 3D
