Lineage for d2e1ya2 (2e1y A:193-397)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) 
duplication contains two domains of this fold
Family c.55.1.2: Acetokinase-like [53080] (3 proteins) Protein Propionate kinase [142462] (1 species) Species Salmonella typhimurium [TaxId:90371] [142463] (5 PDB entries)
Uniprot O06961 193-397! Uniprot O06961 4-192
Domain d2e1ya2: 2e1y A:193-397 [146630]
automatically matched to d1x3ma1
Details for d2e1ya2
PDB Entry: 2e1y (more details), 2.6 Å
PDB Description: crystal structure of propionate kinase (tdcd) from salmonella typhimurium
PDB Compounds: (A:) Propionate kinaseSCOP Domain Sequences for d2e1ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ya2 c.55.1.2 (A:193-397) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka
SCOP Domain Coordinates for d2e1ya2:
Click to download the PDB-style file with coordinates for d2e1ya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2e1ya2:
- d2e1ya2 is new in SCOP 1.75
- d2e1ya2 appears in SCOPe 2.01
- d2e1ya2 appears in the current release, SCOPe 2.08
View in 3D
