SCOPe 2.08: Domain d2e1db_: 2e1d B:

Lineage for d2e1db_ (2e1d B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187041] (2 PDB entries)

8. Domain d2e1db_: 2e1d B: [146628]
   automated match to d1f05a_
   complexed with so3

Details for d2e1db_

PDB Entry: 2e1d, 2 Å

PDB Description: crystal structure of mouse transaldolase

PDB Compounds: (B:) Transaldolase

SCOPe Domain Sequences for d2e1db_:

Sequence; same for both SEQRES and ATOM records:

>d2e1db_ c.1.10.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mesaldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygk
klggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyk
eagvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfv
grildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagc
dfltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsd
girkfaadaiklermltermf

Timeline for d2e1db_:

• d2e1db_ first appeared in SCOP 1.75, called d2e1db1
  
• d2e1db_ appears in SCOPe 2.07