Lineage for d2e1da_ (2e1d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835188Species Mouse (Mus musculus) [TaxId:10090] [187041] (2 PDB entries)
  8. 2835189Domain d2e1da_: 2e1d A: [146627]
    automated match to d1f05a_
    complexed with so3

Details for d2e1da_

PDB Entry: 2e1d (more details), 2 Å

PDB Description: crystal structure of mouse transaldolase
PDB Compounds: (A:) Transaldolase

SCOPe Domain Sequences for d2e1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1da_ c.1.10.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esaldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkk
lggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyke
agvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvg
rildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcd
fltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdg
irkfaadaiklermltermfs

SCOPe Domain Coordinates for d2e1da_:

Click to download the PDB-style file with coordinates for d2e1da_.
(The format of our PDB-style files is described here.)

Timeline for d2e1da_: