SCOPe 2.06: Domain d2e1ca2: 2e1c A:85-170

Lineage for d2e1ca2 (2e1c A:85-170)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
   octamer: tetramer of dimers
   automatically mapped to Pfam PF01037

6. Protein Putative transcriptional regulator PH1519 [102968] (1 species)
   archaeal feast/famine regulatory protein

7. Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries)
   identical sequence to Pyrococcus sp. ot3 protein

8. Domain d2e1ca2: 2e1c A:85-170 [146626]
   Other proteins in same PDB: d2e1ca1
   automated match to d1ri7a2
   protein/DNA complex

Details for d2e1ca2

PDB Entry: 2e1c, 2.1 Å

PDB Description: structure of putative hth-type transcriptional regulator ph1519/dna complex

PDB Compounds: (A:) Putative HTH-type transcriptional regulator PH1519

SCOPe Domain Sequences for d2e1ca2:

Sequence; same for both SEQRES and ATOM records:

>d2e1ca2 d.58.4.2 (A:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi

Timeline for d2e1ca2:

• d2e1ca2 first appeared in SCOP 1.75
  
• d2e1ca2 appears in SCOPe 2.05
  
• d2e1ca2 appears in SCOPe 2.07
  
• d2e1ca2 appears in the current release, SCOPe 2.08