Lineage for d2e1ba2 (2e1b A:88-216)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563701Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563702Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 2563716Family d.67.1.2: AlaX-like [103051] (3 proteins)
  6. 2563717Protein AlaX-M trans-editing enzyme, C-terminal domain [160440] (1 species)
  7. 2563718Species Pyrococcus horikoshii [TaxId:53953] [160441] (1 PDB entry)
    Uniprot O57848 88-216
  8. 2563719Domain d2e1ba2: 2e1b A:88-216 [146624]
    Other proteins in same PDB: d2e1ba1
    complexed with zn

Details for d2e1ba2

PDB Entry: 2e1b (more details), 2.7 Å

PDB Description: Crystal structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii
PDB Compounds: (A:) 216aa long hypothetical alanyl-tRNA synthetase

SCOPe Domain Sequences for d2e1ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1ba2 d.67.1.2 (A:88-216) AlaX-M trans-editing enzyme, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
dwdyryklmrihtglhllehvlnevlgegnwqlvgsgmsvekgrydiaypenlnkykeqi
islfnkyvdeggevkiwwegdrrytqirdfevipcggthvkdikeighikklkrssigrg
kqrlemwle

SCOPe Domain Coordinates for d2e1ba2:

Click to download the PDB-style file with coordinates for d2e1ba2.
(The format of our PDB-style files is described here.)

Timeline for d2e1ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e1ba1