SCOP 1.75: Domain d2e1ba2: 2e1b A:88-216

Lineage for d2e1ba2 (2e1b A:88-216)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.2: AlaX-like [103051] (2 proteins)

6. Protein AlaX-M trans-editing enzyme, C-terminal domain [160440] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [160441] (1 PDB entry)
   Uniprot O57848 88-216

8. Domain d2e1ba2: 2e1b A:88-216 [146624]
   Other proteins in same PDB: d2e1ba1
   complexed with zn

Details for d2e1ba2

PDB Entry: 2e1b, 2.7 Å

PDB Description: Crystal structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii

PDB Compounds: (A:) 216aa long hypothetical alanyl-tRNA synthetase

SCOP Domain Sequences for d2e1ba2:

Sequence; same for both SEQRES and ATOM records:

>d2e1ba2 d.67.1.2 (A:88-216) AlaX-M trans-editing enzyme, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
dwdyryklmrihtglhllehvlnevlgegnwqlvgsgmsvekgrydiaypenlnkykeqi
islfnkyvdeggevkiwwegdrrytqirdfevipcggthvkdikeighikklkrssigrg
kqrlemwle

Timeline for d2e1ba2:

• d2e1ba2 is new in SCOP 1.75
  
• d2e1ba2 appears in SCOPe 2.01
  
• d2e1ba2 appears in the current release, SCOPe 2.08