Lineage for d2e1ba1 (2e1b A:1-87)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793294Family b.43.3.6: AlaX-M N-terminal domain-like [159161] (1 protein)
    Does NOT belong to Pfam PF01411
  6. 2793295Protein AlaX-M trans-editing enzyme, N-terminal domain [159162] (1 species)
  7. 2793296Species Pyrococcus horikoshii [TaxId:53953] [159163] (1 PDB entry)
    Uniprot O57848 1-87
  8. 2793297Domain d2e1ba1: 2e1b A:1-87 [146623]
    Other proteins in same PDB: d2e1ba2
    complexed with zn

Details for d2e1ba1

PDB Entry: 2e1b (more details), 2.7 Å

PDB Description: Crystal structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii
PDB Compounds: (A:) 216aa long hypothetical alanyl-tRNA synthetase

SCOPe Domain Sequences for d2e1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1ba1 b.43.3.6 (A:1-87) AlaX-M trans-editing enzyme, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
minmtrklyyedaylkeakgrvleirdnailldqtifyptgggqphdrgtingvevldvy
kdeegnvwhvvkepekfkvgdevelki

SCOPe Domain Coordinates for d2e1ba1:

Click to download the PDB-style file with coordinates for d2e1ba1.
(The format of our PDB-style files is described here.)

Timeline for d2e1ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e1ba2