SCOPe 2.08: Domain d2e1ba1: 2e1b A:1-87

Lineage for d2e1ba1 (2e1b A:1-87)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.6: AlaX-M N-terminal domain-like [159161] (1 protein)
   Does NOT belong to Pfam PF01411

6. Protein AlaX-M trans-editing enzyme, N-terminal domain [159162] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [159163] (1 PDB entry)
   Uniprot O57848 1-87

8. Domain d2e1ba1: 2e1b A:1-87 [146623]
   Other proteins in same PDB: d2e1ba2
   complexed with zn

Details for d2e1ba1

PDB Entry: 2e1b, 2.7 Å

PDB Description: Crystal structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii

PDB Compounds: (A:) 216aa long hypothetical alanyl-tRNA synthetase

SCOPe Domain Sequences for d2e1ba1:

Sequence; same for both SEQRES and ATOM records:

>d2e1ba1 b.43.3.6 (A:1-87) AlaX-M trans-editing enzyme, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
minmtrklyyedaylkeakgrvleirdnailldqtifyptgggqphdrgtingvevldvy
kdeegnvwhvvkepekfkvgdevelki

Timeline for d2e1ba1:

• d2e1ba1 first appeared in SCOP 1.75
  
• d2e1ba1 appears in SCOPe 2.07