Lineage for d2e0ha_ (2e0h A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030457Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 3030458Protein alpha toxin [57111] (4 species)
    Anti-mammal and anti-insect scorpion toxin
  7. 3030459Species Chinese scorpion (Buthus martensii karsch) [TaxId:34649] [103539] (2 PDB entries)
  8. 3030461Domain d2e0ha_: 2e0h A: [146622]
    automated match to d1omya_

Details for d2e0ha_

PDB Entry: 2e0h (more details)

PDB Description: solution structure of bmkalphait01, an alpha-insect toxin from the venom of the chinese scorpion buthus martensi karsch
PDB Compounds: (A:) Alpha-neurotoxin TX12

SCOPe Domain Sequences for d2e0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e0ha_ g.3.7.1 (A:) alpha toxin {Chinese scorpion (Buthus martensii karsch) [TaxId: 34649]}
vrdayiaqnyncvyhcardaycnelctkngaksgscpylgehkfacyckdlpdnvpirvp
gkch

SCOPe Domain Coordinates for d2e0ha_:

Click to download the PDB-style file with coordinates for d2e0ha_.
(The format of our PDB-style files is described here.)

Timeline for d2e0ha_: