Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186823] (3 PDB entries) |
Domain d2dzoc_: 2dzo C: [146621] automated match to d2dznc_ applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2dzo (more details), 3 Å
SCOPe Domain Sequences for d2dzoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dzoc_ d.211.1.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} snyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmen vnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfe vsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfha laeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
Timeline for d2dzoc_: