SCOPe 2.05: Domain d2dzoa_: 2dzo A:

Lineage for d2dzoa_ (2dzo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186823] (3 PDB entries)

8. Domain d2dzoa_: 2dzo A: [146620]
   automated match to d2dznc_

Details for d2dzoa_

PDB Entry: 2dzo, 3 Å

PDB Description: Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3

PDB Compounds: (A:) Probable 26S proteasome regulatory subunit p28

SCOPe Domain Sequences for d2dzoa_:

Sequence; same for both SEQRES and ATOM records:

>d2dzoa_ d.211.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv

Timeline for d2dzoa_:

• d2dzoa_ first appeared in SCOP 1.75, called d2dzoa1
  
• d2dzoa_ appears in SCOPe 2.04
  
• d2dzoa_ appears in SCOPe 2.06
  
• d2dzoa_ appears in the current release, SCOPe 2.08