Lineage for d2dzoa_ (2dzo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006612Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186823] (3 PDB entries)
  8. 3006617Domain d2dzoa_: 2dzo A: [146620]
    automated match to d2dznc_
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2dzoa_

PDB Entry: 2dzo (more details), 3 Å

PDB Description: Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
PDB Compounds: (A:) Probable 26S proteasome regulatory subunit p28

SCOPe Domain Sequences for d2dzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzoa_ d.211.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv

SCOPe Domain Coordinates for d2dzoa_:

Click to download the PDB-style file with coordinates for d2dzoa_.
(The format of our PDB-style files is described here.)

Timeline for d2dzoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dzoc_