Lineage for d2dzna_ (2dzn A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050794Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1050795Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1050796Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1050885Protein automated matches [190101] (4 species)
    not a true protein
  7. 1050886Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186823] (2 PDB entries)
  8. 1050887Domain d2dzna_: 2dzn A: [146617]
    automated match to d1ixva_

Details for d2dzna_

PDB Entry: 2dzn (more details), 2.2 Å

PDB Description: Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
PDB Compounds: (A:) Probable 26S proteasome regulatory subunit p28

SCOPe Domain Sequences for d2dzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzna_ d.211.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv

SCOPe Domain Coordinates for d2dzna_:

Click to download the PDB-style file with coordinates for d2dzna_.
(The format of our PDB-style files is described here.)

Timeline for d2dzna_: