![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (1 family) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (17 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (4 PDB entries) |
![]() | Domain d2dzna1: 2dzn A:3-228 [146617] automatically matched to d1ixva_ |
PDB Entry: 2dzn (more details), 2.2 Å
SCOP Domain Sequences for d2dzna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dzna1 d.211.1.1 (A:3-228) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
Timeline for d2dzna1: