Lineage for d2dzeb1 (2dze B:2-161)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 938308Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 938309Family b.1.22.1: ASF1-like [101547] (1 protein)
  6. 938310Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 938315Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
    Uniprot O74515 1-161
  8. 938318Domain d2dzeb1: 2dze B:2-161 [146616]
    automatically matched to 2CU9 A:1-161
    complexed with pge

Details for d2dzeb1

PDB Entry: 2dze (more details), 1.8 Å

PDB Description: Crystal structure of histone chaperone Asf1 in complex with a C-terminus of histone H3
PDB Compounds: (B:) Histone chaperone cia1

SCOPe Domain Sequences for d2dzeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzeb1 b.1.22.1 (B:2-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn

SCOPe Domain Coordinates for d2dzeb1:

Click to download the PDB-style file with coordinates for d2dzeb1.
(The format of our PDB-style files is described here.)

Timeline for d2dzeb1: