SCOPe 2.08: Domain d2dzea_: 2dze A:

Lineage for d2dzea_ (2dze A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
   Uniprot O74515 1-161

8. Domain d2dzea_: 2dze A: [146615]
   automated match to d2cu9a1
   complexed with pge

Details for d2dzea_

PDB Entry: 2dze, 1.8 Å

PDB Description: Crystal structure of histone chaperone Asf1 in complex with a C-terminus of histone H3

PDB Compounds: (A:) Histone chaperone cia1

SCOPe Domain Sequences for d2dzea_:

Sequence; same for both SEQRES and ATOM records:

>d2dzea_ b.1.22.1 (A:) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwd

Timeline for d2dzea_:

• d2dzea_ first appeared in SCOP 1.75, called d2dzea1
  
• d2dzea_ appears in SCOPe 2.07