SCOPe 2.05: Domain d2dyha_: 2dyh A:

Lineage for d2dyha_ (2dyh A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186850] (3 PDB entries)

8. Domain d2dyha_: 2dyh A: [146612]
   automated match to d1x2ja1
   complexed with so4

Details for d2dyha_

PDB Entry: 2dyh, 1.9 Å

PDB Description: Crystal structure of the Keap1 protein in complexed with the N-terminal region of the Nrf2 transcription factor

PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d2dyha_:

Sequence; same for both SEQRES and ATOM records:

>d2dyha_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepcrkqidq

Timeline for d2dyha_:

• d2dyha_ first appeared in SCOP 1.75, called d2dyha1
  
• d2dyha_ appears in SCOPe 2.04
  
• d2dyha_ appears in SCOPe 2.06
  
• d2dyha_ appears in the current release, SCOPe 2.08