![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.11: Kelch motif [117281] (2 families) ![]() |
![]() | Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
![]() | Protein automated matches [190126] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186850] (3 PDB entries) |
![]() | Domain d2dyha_: 2dyh A: [146612] automated match to d1x2ja1 complexed with so4 |
PDB Entry: 2dyh (more details), 1.9 Å
SCOPe Domain Sequences for d2dyha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyha_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepcrkqidq
Timeline for d2dyha_: