SCOP 1.75: Domain d2dyha1: 2dyh A:324-613

Lineage for d2dyha1 (2dyh A:324-613)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (1 family)

5. Family b.68.11.1: Kelch motif [117282] (1 protein)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain ((50967))

6. Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141550] (4 PDB entries)
   Uniprot Q9Z2X8 324-613

8. Domain d2dyha1: 2dyh A:324-613 [146612]
   automatically matched to d1x2ja1
   complexed with so4

Details for d2dyha1

PDB Entry: 2dyh, 1.9 Å

PDB Description: Crystal structure of the Keap1 protein in complexed with the N-terminal region of the Nrf2 transcription factor

PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOP Domain Sequences for d2dyha1:

Sequence; same for both SEQRES and ATOM records:

>d2dyha1 b.68.11.1 (A:324-613) Kelch-like ECH-associated protein 1, KEAP1 {Mouse (Mus musculus) [TaxId: 10090]}
vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc

Timeline for d2dyha1:

• d2dyha1 is new in SCOP 1.75
  
• d2dyha1 is called d2dyha_ in SCOPe 2.01
  
• d2dyha1 appears in the current release, SCOPe 2.08, called d2dyha_