Lineage for d2dy1a5 (2dy1 A:570-665)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653322Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 1653323Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 1653376Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 1653392Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (2 PDB entries)
    Uniprot Q5SI76 371-447! Uniprot Q5SI76 563-658
    TTHA1498
  8. 1653394Domain d2dy1a5: 2dy1 A:570-665 [146611]
    Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a3
    automated match to d1wdta4
    complexed with gtp, mg

Details for d2dy1a5

PDB Entry: 2dy1 (more details), 1.6 Å

PDB Description: Crystal structure of EF-G-2 from Thermus thermophilus
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2dy1a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]}
vllepiyrlkvlapqervgdvlsdlqarrgrilgmeqegalsvvhaevplaevleyykal
pgltggagaytlefshyaevpphlaqrivqeraqeg

SCOPe Domain Coordinates for d2dy1a5:

Click to download the PDB-style file with coordinates for d2dy1a5.
(The format of our PDB-style files is described here.)

Timeline for d2dy1a5: