SCOPe 2.05: Domain d2dy1a3: 2dy1 A:455-569

Lineage for d2dy1a3 (2dy1 A:455-569)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Elongation factor G (EF-G), domain IV [54213] (2 species)

7. Species Thermus thermophilus, EF-G-2 [TaxId:274] [142925] (2 PDB entries)
   Uniprot Q5SI76 448-562
   TTHA1498

8. Domain d2dy1a3: 2dy1 A:455-569 [146609]
   Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a4, d2dy1a5
   automated match to d1wdta3
   complexed with gtp, mg

Details for d2dy1a3

PDB Entry: 2dy1, 1.6 Å

PDB Description: Crystal structure of EF-G-2 from Thermus thermophilus

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2dy1a3:

Sequence; same for both SEQRES and ATOM records:

>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pyretikkvaegqgkykkqtgghgqygdvwlrlepaseygfewritggvipskyqeaiee
gikeaakkgvlagfpvmgfkaivyngsyhevdssdlafqiaaslafkkvmaeahp

Timeline for d2dy1a3:

• d2dy1a3 first appeared in SCOP 1.75
  
• d2dy1a3 appears in SCOPe 2.04
  
• d2dy1a3 appears in SCOPe 2.06
  
• d2dy1a3 appears in the current release, SCOPe 2.08