| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species) has internal nucleotide exchange factor built in as an insertion subdomain |
| Species Thermus thermophilus, EF-G-2 [TaxId:274] [142226] (2 PDB entries) Uniprot Q5SI76 1-267 TTHA1498 |
| Domain d2dy1a2: 2dy1 A:8-274 [146608] Other proteins in same PDB: d2dy1a1, d2dy1a3, d2dy1a4, d2dy1a5, d2dy1a6 automated match to d1wdta2 complexed with gtp, mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 2dy1 (more details), 1.6 Å
SCOPe Domain Sequences for d2dy1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}
mirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtgva
pllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerlgl
prmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryenge
ereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrgll
ypvalasgereigvlpllelilealps
Timeline for d2dy1a2: