SCOPe 2.08: Domain d2dy1a2: 2dy1 A:8-274

Lineage for d2dy1a2 (2dy1 A:8-274)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
   has internal nucleotide exchange factor built in as an insertion subdomain

7. Species Thermus thermophilus, EF-G-2 [TaxId:274] [142226] (2 PDB entries)
   Uniprot Q5SI76 1-267
   TTHA1498

8. Domain d2dy1a2: 2dy1 A:8-274 [146608]
   Other proteins in same PDB: d2dy1a1, d2dy1a3, d2dy1a4, d2dy1a5, d2dy1a6
   automated match to d1wdta2
   complexed with gtp, mg
   has additional subdomain(s) that are not in the common domain

Details for d2dy1a2

PDB Entry: 2dy1, 1.6 Å

PDB Description: Crystal structure of EF-G-2 from Thermus thermophilus

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2dy1a2:

Sequence; same for both SEQRES and ATOM records:

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}
mirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtgva
pllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerlgl
prmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryenge
ereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrgll
ypvalasgereigvlpllelilealps

Timeline for d2dy1a2:

• d2dy1a2 first appeared in SCOP 1.75
  
• d2dy1a2 appears in SCOPe 2.07