SCOPe 2.08: Domain d2dxlb_: 2dxl B:

Lineage for d2dxlb_ (2dxl B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.11: GpdQ-like [160875] (2 proteins)
   part of Pfam PF00149

6. Protein Glycerophosphodiesterase GpdQ [160878] (1 species)

7. Species Enterobacter aerogenes [TaxId:548] [160879] (5 PDB entries)
   Uniprot Q6XBH1 1-271

8. Domain d2dxlb_: 2dxl B: [146602]
   automated match to d3d03a_
   complexed with co

Details for d2dxlb_

PDB Entry: 2dxl, 3 Å

PDB Description: Glycerophosphodiesterase from Enterobacter aerogenes

PDB Compounds: (B:) Phosphohydrolase

SCOPe Domain Sequences for d2dxlb_:

Sequence; same for both SEQRES and ATOM records:

>d2dxlb_ d.159.1.11 (B:) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}
mllahisdthfrsrgeklygfidvnaanadvvsqlnalrerpdavvvsgdivncgrpeey
qvarqilgslnyplylipgnhddkalfleylqplcpqlgsdannmrcavddfatrllfid
ssragtskgwltdetiswleaqlfeggdkpatifmhhpplplgnaqmdpiacenghrlla
lverfpsltrifcghnhsltmtqyrqalistlpgtvhqvpychedtdpyydlspasclmh
rqvgeqwvsyqhslahyagpwlydeniscpt

Timeline for d2dxlb_:

• d2dxlb_ first appeared in SCOP 1.75, called d2dxlb1
  
• d2dxlb_ appears in SCOPe 2.07