SCOPe 2.08: Domain d2dx7b1: 2dx7 B:116-228

Lineage for d2dx7b1 (2dx7 B:116-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins)
   C-terminal extension is added to the N-terminal domain

6. Protein Aspartate racemase [75310] (1 species)

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [159783] (3 PDB entries)

8. Domain d2dx7b1: 2dx7 B:116-228 [146600]
   automated match to d1jfla2
   complexed with cit

Details for d2dx7b1

PDB Entry: 2dx7, 2 Å

PDB Description: crystal structure of pyrococcus horikoshii ot3 aspartate racemase complex with citric acid

PDB Compounds: (B:) aspartate racemase

SCOPe Domain Sequences for d2dx7b1:

Sequence; same for both SEQRES and ATOM records:

>d2dx7b1 c.78.2.1 (B:116-228) Aspartate racemase {Pyrococcus horikoshii OT3 [TaxId: 70601]}
fkkagllattgtivsgvyekefskygveimtptedeqkdvmrgiyegvkagnlklgrell
lktakileergaeciiagctevsvvlkqddlkvplidpmdviaevavkvalek

Timeline for d2dx7b1:

• d2dx7b1 first appeared in SCOP 1.75
  
• d2dx7b1 appears in SCOPe 2.07