SCOP 1.75: Domain d2dwfa1: 2dwf A:1-34

Lineage for d2dwfa1 (2dwf A:1-34)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)

4. Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family)

5. Family j.35.1.1: Transmembrane helical fragments [58519] (29 proteins)
   the member of this family may be not related

6. Protein Surfactant Protein B (SP-B) miniprotein constructs [58528] (1 species)

7. Species Synthetic, based on Homo sapiens sequence [58529] (7 PDB entries)
   Uniprot P07988 208-225,263-278

8. Domain d2dwfa1: 2dwf A:1-34 [146598]
   automatically matched to 2JOU A:1-34

Details for d2dwfa1

PDB Entry: 2dwf

PDB Description: nmr structure of mini-b, an n-terminal- c-terminal construct from human surfactant protein b (sp-b), in sodium dodecyl sulfate (sds) micelles

PDB Compounds: (A:) Pulmonary surfactant-associated protein B

SCOP Domain Sequences for d2dwfa1:

Sequence; same for both SEQRES and ATOM records:

>d2dwfa1 j.35.1.1 (A:1-34) Surfactant Protein B (SP-B) miniprotein constructs {Synthetic, based on Homo sapiens sequence}
cwlcralikriqamipkggrmlpqlvcrlvlrcs

Timeline for d2dwfa1:

• d2dwfa1 is new in SCOP 1.75
  
• d2dwfa1 appears in SCOPe 2.01
  
• d2dwfa1 appears in the current release, SCOPe 2.08