| Class j: Peptides [58231] (151 folds) |
| Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
| Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
| Protein Surfactant Protein B (SP-B) miniprotein constructs [58528] (1 species) |
| Species Synthetic, based on Homo sapiens sequence [58529] (7 PDB entries) Uniprot P07988 208-225,263-278 |
| Domain d2dwfa1: 2dwf A:1-34 [146598] automatically matched to 2JOU A:1-34 |
PDB Entry: 2dwf (more details)
SCOPe Domain Sequences for d2dwfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwfa1 j.35.1.1 (A:1-34) Surfactant Protein B (SP-B) miniprotein constructs {Synthetic, based on Homo sapiens sequence}
cwlcralikriqamipkggrmlpqlvcrlvlrcs
Timeline for d2dwfa1: