Lineage for d2dw4a3 (2dw4 A:655-763)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180483Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2180484Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2180697Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2180721Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)
  7. 2180722Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
    Uniprot O60341 655-763
  8. 2180723Domain d2dw4a3: 2dw4 A:655-763 [146596]
    Other proteins in same PDB: d2dw4a1, d2dw4a2
    automatically matched to 2IW5 A:655-763
    complexed with fad

Details for d2dw4a3

PDB Entry: 2dw4 (more details), 2.3 Å

PDB Description: Crystal structure of human LSD1 at 2.3 A resolution
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2dw4a3:

Sequence, based on SEQRES records: (download)

>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

Sequence, based on observed residues (ATOM records): (download)

>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlapillalvageaagime
nisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

SCOPe Domain Coordinates for d2dw4a3:

Click to download the PDB-style file with coordinates for d2dw4a3.
(The format of our PDB-style files is described here.)

Timeline for d2dw4a3: