Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159954] (8 PDB entries) Uniprot O60341 655-763 |
Domain d2dw4a3: 2dw4 A:655-763 [146596] Other proteins in same PDB: d2dw4a1, d2dw4a2 automatically matched to 2IW5 A:655-763 complexed with fad |
PDB Entry: 2dw4 (more details), 2.3 Å
SCOPe Domain Sequences for d2dw4a3:
Sequence, based on SEQRES records: (download)
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlapillalvageaagime nisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy
Timeline for d2dw4a3: