SCOPe 2.07: Domain d2dvna_: 2dvn A:

Lineage for d2dvna_ (2dvn A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein XTP pyrophosphatase [52974] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries)
   PH1917

8. Domain d2dvna_: 2dvn A: [146590]
   automated match to d1v7ra_
   complexed with gol, imp, so4

Details for d2dvna_

PDB Entry: 2dvn, 1.6 Å

PDB Description: Structure of PH1917 protein with the complex of IMP from Pyrococcus horikoshii

PDB Compounds: (A:) Hypothetical protein PH1917

SCOPe Domain Sequences for d2dvna_:

Sequence; same for both SEQRES and ATOM records:

>d2dvna_ c.51.4.1 (A:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnlky

Timeline for d2dvna_:

• d2dvna_ first appeared in SCOP 1.75, called d2dvna1
  
• d2dvna_ appears in SCOPe 2.06
  
• d2dvna_ appears in the current release, SCOPe 2.08