SCOP 1.75: Domain d2dvna1: 2dvn A:1-186

Lineage for d2dvna1 (2dvn A:1-186)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (3 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein XTP pyrophosphatase [52974] (2 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102470] (5 PDB entries)
   PH1917

8. Domain d2dvna1: 2dvn A:1-186 [146590]
   automatically matched to d1v7ra_
   complexed with gol, imp, so4

Details for d2dvna1

PDB Entry: 2dvn, 1.6 Å

PDB Description: Structure of PH1917 protein with the complex of IMP from Pyrococcus horikoshii

PDB Compounds: (A:) Hypothetical protein PH1917

SCOP Domain Sequences for d2dvna1:

Sequence; same for both SEQRES and ATOM records:

>d2dvna1 c.51.4.1 (A:1-186) XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnlky

Timeline for d2dvna1:

• d2dvna1 is new in SCOP 1.75
  
• d2dvna1 is called d2dvna_ in SCOPe 2.01
  
• d2dvna1 appears in the current release, SCOPe 2.08, called d2dvna_