![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.7: ComEA-like [158534] (2 proteins) sequence similarity to the HhH-motif domains of the PsbU-like and Tex-like families |
![]() | Protein Uncharacterized protein TTHA1967 [158535] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158536] (1 PDB entry) Uniprot Q5SGW3 11-75 |
![]() | Domain d2duya1: 2duy A:11-75 [146589] complexed with cl |
PDB Entry: 2duy (more details), 1.75 Å
SCOPe Domain Sequences for d2duya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} plpqaqtpvslneasleelmalpgigpvlarrivegrpyarvedllkvkgigpatlerlr pylrp
Timeline for d2duya1: