Lineage for d2duya1 (2duy A:11-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715755Family a.60.2.7: ComEA-like [158534] (2 proteins)
    sequence similarity to the HhH-motif domains of the PsbU-like and Tex-like families
  6. 2715759Protein Uncharacterized protein TTHA1967 [158535] (1 species)
  7. 2715760Species Thermus thermophilus [TaxId:274] [158536] (1 PDB entry)
    Uniprot Q5SGW3 11-75
  8. 2715761Domain d2duya1: 2duy A:11-75 [146589]
    complexed with cl

Details for d2duya1

PDB Entry: 2duy (more details), 1.75 Å

PDB Description: Crystal structure of competence protein ComEA-related protein from Thermus thermophilus HB8
PDB Compounds: (A:) Competence protein ComEA-related protein

SCOPe Domain Sequences for d2duya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]}
plpqaqtpvslneasleelmalpgigpvlarrivegrpyarvedllkvkgigpatlerlr
pylrp

SCOPe Domain Coordinates for d2duya1:

Click to download the PDB-style file with coordinates for d2duya1.
(The format of our PDB-style files is described here.)

Timeline for d2duya1: