Lineage for d2dula1 (2dul A:3-377)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130520Family c.66.1.58: TRM1-like [159697] (1 protein)
    Pfam PF02005; contains extra C-terminal alpha+beta subdomain
  6. 2130521Protein N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 [159698] (1 species)
  7. 2130522Species Pyrococcus horikoshii [TaxId:53953] [159699] (4 PDB entries)
    Uniprot O59493 3-377
  8. 2130523Domain d2dula1: 2dul A:3-377 [146588]
    complexed with gol

Details for d2dula1

PDB Entry: 2dul (more details), 1.9 Å

PDB Description: Crystal structure of tRNA G26 methyltransferase Trm1 in apo form from Pyrococcus horikoshii
PDB Compounds: (A:) N(2),N(2)-dimethylguanosine tRNA methyltransferase

SCOPe Domain Sequences for d2dula1:

Sequence, based on SEQRES records: (download)

>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]}
lievqegkakilipkaesiydspvfynprmalnrdivvvllnilnpkivldalsatgirg
irfaletpaeevwlndisedayelmkrnvmlnfdgelreskgrailkgektivinhddan
rlmaerhryfhfidldpfgspmefldtalrsakrrgilgvtatdgaplcgahpraclrky
lavplrgelchevgtrilvgviaryaakydlgidvilayykdhyfrafvklkdgarkgde
tleklgyiyfddktgkfeleqgflptrpnaygpvwlgplkdekivskmvkeaeslslark
kqalkllkmidqeldiplfydthaigrrlkietkkveeiisalreqgyeatrthfsptgi
ktsapyevfietikr

Sequence, based on observed residues (ATOM records): (download)

>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]}
lievqegkakilippvfynprmalnrdivvvllnilnpkivldalsatgirgirfaletp
aeevwlndisedayelmkrnvmlnfdgelreskgrailkgektivinhddanrlmaerhr
yfhfidldpfgspmefldtalrsakrrgilgvtatdgaplcgahpraclrkylavplrge
lchevgtrilvgviaryaakydlgidvilayykdhyfrafvklkdgarkgdetleklgyi
yfddktgkfeleqgflptrpnaygpvwlgplkdekivskmvkeaeslslarkkqalkllk
midqeldiplfydthaigrrlkietkkveeiisalreqgyeatrthfsptgiktsapyev
fietikr

SCOPe Domain Coordinates for d2dula1:

Click to download the PDB-style file with coordinates for d2dula1.
(The format of our PDB-style files is described here.)

Timeline for d2dula1: