Lineage for d2duca_ (2duc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795288Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1795345Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 1795366Species SARS coronavirus [TaxId:227859] [89349] (65 PDB entries)
  8. 1795372Domain d2duca_: 2duc A: [146586]
    automated match to d1uj1b_

Details for d2duca_

PDB Entry: 2duc (more details), 1.7 Å

PDB Description: crystal structure of sars coronavirus main proteinase(3clpro)
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2duca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2duca_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d2duca_:

Click to download the PDB-style file with coordinates for d2duca_.
(The format of our PDB-style files is described here.)

Timeline for d2duca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ducb_