Lineage for d2duca1 (2duc A:2-301)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803590Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 803620Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
    contains an extra alpha-helical domain
  7. 803624Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries)
  8. 803625Domain d2duca1: 2duc A:2-301 [146586]
    automatically matched to d1q2wb_

Details for d2duca1

PDB Entry: 2duc (more details), 1.7 Å

PDB Description: crystal structure of sars coronavirus main proteinase(3clpro)
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOP Domain Sequences for d2duca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2duca1 b.47.1.4 (A:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

SCOP Domain Coordinates for d2duca1:

Click to download the PDB-style file with coordinates for d2duca1.
(The format of our PDB-style files is described here.)

Timeline for d2duca1: