Lineage for d2dtzd2 (2dtz D:73-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008196Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2008197Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2008226Domain d2dtzd2: 2dtz D:73-187 [146583]
    Other proteins in same PDB: d2dtza1, d2dtzb1, d2dtzd1, d2dtze1
    automated match to d1rkwa2
    complexed with so4

Details for d2dtzd2

PDB Entry: 2dtz (more details), 2.8 Å

PDB Description: Crystal Structure of multidrug binding protein QacR from Staphylococcus aureus cocrystallized with compound DB75
PDB Compounds: (D:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2dtzd2:

Sequence, based on SEQRES records: (download)

>d2dtzd2 a.121.1.1 (D:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Sequence, based on observed residues (ATOM records): (download)

>d2dtzd2 a.121.1.1 (D:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d2dtzd2:

Click to download the PDB-style file with coordinates for d2dtzd2.
(The format of our PDB-style files is described here.)

Timeline for d2dtzd2: