Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries) Uniprot P23217 |
Domain d2dtzb1: 2dtz B:2-72 [146580] Other proteins in same PDB: d2dtza2, d2dtzb2, d2dtzd2, d2dtze2 automated match to d1rkwa1 complexed with so4 |
PDB Entry: 2dtz (more details), 2.8 Å
SCOPe Domain Sequences for d2dtzb1:
Sequence, based on SEQRES records: (download)
>d2dtzb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqika
>d2dtzb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} nlkdkilgvakelfikngynatttgeivklsesskgnlfktkenlfleilnieeskwqeq wkkeqika
Timeline for d2dtzb1: