SCOPe 2.08: Domain d2dsua2: 2dsu A:240-307

Lineage for d2dsua2 (2dsu A:240-307)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries)
   Uniprot Q6TMG6

8. Domain d2dsua2: 2dsu A:240-307 [146564]
   Other proteins in same PDB: d2dsua1
   automated match to d1sr0a2

Details for d2dsua2

PDB Entry: 2dsu, 2.2 Å

PDB Description: binding of chitin-like polysaccharide to protective signalling factor: crystal structure of the complex formed between signalling protein from sheep (sps-40) with a tetrasaccharide at 2.2 a resolution

PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2dsua2:

Sequence; same for both SEQRES and ATOM records:

>d2dsua2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d2dsua2:

• d2dsua2 first appeared in SCOP 1.75
  
• d2dsua2 appears in SCOPe 2.07