SCOP 1.75: Domain d2dstb1: 2dst B:2-123

Lineage for d2dstb1 (2dst B:2-123)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.39: TTHA1544-like [159753] (1 protein)
   minimal hydrolase fold (one strand less than the cutinase-like family); there is neither catalytic triad, nor nucleopilic residue in the elbow motif

6. Protein Hypothetical protein TTHA1544 [159754] (1 species)

7. Species Thermus thermophilus [TaxId:274] [159755] (1 PDB entry)
   Uniprot Q5SI36 2-123

8. Domain d2dstb1: 2dst B:2-123 [146562]
   automatically matched to 2DST A:2-123

Details for d2dstb1

PDB Entry: 2dst, 2 Å

PDB Description: Crystal Structure Analysis of TT1977

PDB Compounds: (B:) Hypothetical protein TTHA1544

SCOP Domain Sequences for d2dstb1:

Sequence; same for both SEQRES and ATOM records:

>d2dstb1 c.69.1.39 (B:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}
rragylhlyglnlvfdrvgkgppvllvaeeasrwpealpegyafylldlpgygrtegprm
apeelahfvagfavmmnlgapwvllrglglalgphlealglralpaegvevaevlsskls
yg

Timeline for d2dstb1:

• d2dstb1 is new in SCOP 1.75
  
• d2dstb1 is called d2dstb_ in SCOPe 2.01
  
• d2dstb1 appears in the current release, SCOPe 2.08, called d2dstb_