SCOPe 2.08: Domain d2dstb_: 2dst B:

Lineage for d2dstb_ (2dst B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.39: TTHA1544-like [159753] (2 proteins)
   minimal hydrolase fold (one strand less than the cutinase-like family); there is neither catalytic triad, nor nucleopilic residue in the elbow motif

6. Protein automated matches [190612] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187634] (1 PDB entry)

8. Domain d2dstb_: 2dst B: [146562]
   Other proteins in same PDB: d2dsta1
   automated match to d2dsta1

Details for d2dstb_

PDB Entry: 2dst, 2 Å

PDB Description: Crystal Structure Analysis of TT1977

PDB Compounds: (B:) Hypothetical protein TTHA1544

SCOPe Domain Sequences for d2dstb_:

Sequence; same for both SEQRES and ATOM records:

>d2dstb_ c.69.1.39 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
rragylhlyglnlvfdrvgkgppvllvaeeasrwpealpegyafylldlpgygrtegprm
apeelahfvagfavmmnlgapwvllrglglalgphlealglralpaegvevaevlsskls
yg

Timeline for d2dstb_:

• d2dstb_ first appeared in SCOP 1.75, called d2dstb1
  
• d2dstb_ appears in SCOPe 2.07