![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.39: TTHA1544-like [159753] (2 proteins) minimal hydrolase fold (one strand less than the cutinase-like family); there is neither catalytic triad, nor nucleopilic residue in the elbow motif |
![]() | Protein Hypothetical protein TTHA1544 [159754] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [159755] (1 PDB entry) Uniprot Q5SI36 2-123 |
![]() | Domain d2dsta1: 2dst A:2-123 [146561] Other proteins in same PDB: d2dstb_ |
PDB Entry: 2dst (more details), 2 Å
SCOPe Domain Sequences for d2dsta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} rragylhlyglnlvfdrvgkgppvllvaeeasrwpealpegyafylldlpgygrtegprm apeelahfvagfavmmnlgapwvllrglglalgphlealglralpaegvevaevlsskls yg
Timeline for d2dsta1: