![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.372: YqaI-like [160712] (1 superfamily) dimeric zinc-less 'zinc finger'-like fold; similar to the C-terminal strand-swapped B-box domain (57844) |
![]() | Superfamily d.372.1: YqaI-like [160713] (1 family) ![]() automatically mapped to Pfam PF09466 |
![]() | Family d.372.1.1: YqaI-like [160714] (1 protein) Pfam PF09466 |
![]() | Protein Hypothetical protein YqaI [160715] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [160716] (1 PDB entry) Uniprot P45906 1-64 |
![]() | Domain d2dsma1: 2dsm A:1-64 [146559] Other proteins in same PDB: d2dsma2, d2dsmb3 |
PDB Entry: 2dsm (more details)
SCOPe Domain Sequences for d2dsma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsma1 d.372.1.1 (A:1-64) Hypothetical protein YqaI {Bacillus subtilis [TaxId: 1423]} mvenpmvinnwhdkltetdvqidfygdevtpvddyvidggeiilrenlerylreqlgfef knaq
Timeline for d2dsma1: