SCOPe 2.08: Domain d2dsma1: 2dsm A:1-64

Lineage for d2dsma1 (2dsm A:1-64)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.372: YqaI-like [160712] (1 superfamily)
   dimeric zinc-less 'zinc finger'-like fold; similar to the C-terminal strand-swapped B-box domain (57844)

4. Superfamily d.372.1: YqaI-like [160713] (1 family)
   automatically mapped to Pfam PF09466

5. Family d.372.1.1: YqaI-like [160714] (1 protein)
   Pfam PF09466

6. Protein Hypothetical protein YqaI [160715] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160716] (1 PDB entry)
   Uniprot P45906 1-64

8. Domain d2dsma1: 2dsm A:1-64 [146559]
   Other proteins in same PDB: d2dsma2, d2dsmb3

Details for d2dsma1

PDB Entry: 2dsm

PDB Description: nmr structure of bacillus subtilis protein yqai, northeast structural genomics target sr450

PDB Compounds: (A:) Hypothetical protein yqaI

SCOPe Domain Sequences for d2dsma1:

Sequence; same for both SEQRES and ATOM records:

>d2dsma1 d.372.1.1 (A:1-64) Hypothetical protein YqaI {Bacillus subtilis [TaxId: 1423]}
mvenpmvinnwhdkltetdvqidfygdevtpvddyvidggeiilrenlerylreqlgfef
knaq

Timeline for d2dsma1:

• d2dsma1 first appeared in SCOP 1.75
  
• d2dsma1 appears in SCOPe 2.07