Lineage for d2dq5a1 (2dq5 A:168-214)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893784Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 893785Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) (S)
  5. 893786Family g.43.1.1: B-box zinc-binding domain [57846] (7 proteins)
  6. 893787Protein Midline-1 [161198] (1 species)
  7. 893788Species Human (Homo sapiens) [TaxId:9606] [161199] (1 PDB entry)
    Uniprot O15344 168-214
  8. 893789Domain d2dq5a1: 2dq5 A:168-214 [146556]
    complexed with zn

Details for d2dq5a1

PDB Entry: 2dq5 (more details)

PDB Description: solution structure of the mid1 b box2 chc(d/c)c2h2 zinc-binding domain: insights into an evolutionary conserved ring fold
PDB Compounds: (A:) Midline-1

SCOP Domain Sequences for d2dq5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]}
shirglmclehedekvnmycvtddqlicalcklvgrhrdhqvaalse

SCOP Domain Coordinates for d2dq5a1:

Click to download the PDB-style file with coordinates for d2dq5a1.
(The format of our PDB-style files is described here.)

Timeline for d2dq5a1: