Lineage for d2dpwa1 (2dpw A:1-231)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899238Family c.68.1.19: TTHA0179-like [159717] (1 protein)
    automatically mapped to Pfam PF12804
  6. 2899239Protein Uncharacterized protein TTHA0179 [159718] (1 species)
  7. 2899240Species Thermus thermophilus [TaxId:274] [159719] (1 PDB entry)
    Uniprot Q5SLW4 1-231
  8. 2899241Domain d2dpwa1: 2dpw A:1-231 [146555]
    complexed with na

Details for d2dpwa1

PDB Entry: 2dpw (more details), 2.9 Å

PDB Description: Hpothetical Transferase Structure from Thermus thermophilus
PDB Compounds: (A:) Hypothetical protein TTHA0179

SCOPe Domain Sequences for d2dpwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]}
mrpsaivlaggkeawaerfgvgskalvpyrgrpmvewvlealyaaglspvyvgenpglvp
apaltlpdrggllenleqalehvegrvlvatgdiphlteeavrfvldkapeaalvypivp
keavearfprtkrtyarlregtftggnlllldkslfrkalplarrvvalrkrplalarlv
gwdvllklllgrlslaevearaqrilgvearalvtpypevgvdvdreedlv

SCOPe Domain Coordinates for d2dpwa1:

Click to download the PDB-style file with coordinates for d2dpwa1.
(The format of our PDB-style files is described here.)

Timeline for d2dpwa1: