| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
| Species Sheep (Ovis aries) [TaxId:9940] [109621] (12 PDB entries) Uniprot Q6TMG6 |
| Domain d2dpea2: 2dpe A:240-307 [146554] Other proteins in same PDB: d2dpea1 automatically matched to d1ljya2 complexed with bma, man, nag |
PDB Entry: 2dpe (more details), 2.07 Å
SCOP Domain Sequences for d2dpea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dpea2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay
Timeline for d2dpea2: