SCOP 1.75: Domain d2dpea2: 2dpe A:240-307

Lineage for d2dpea2 (2dpe A:240-307)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109621] (12 PDB entries)
   Uniprot Q6TMG6

8. Domain d2dpea2: 2dpe A:240-307 [146554]
   Other proteins in same PDB: d2dpea1
   automatically matched to d1ljya2
   complexed with bma, man, nag

Details for d2dpea2

PDB Entry: 2dpe, 2.07 Å

PDB Description: crystal structure of a secretory 40kda glycoprotein from sheep at 2.0a resolution

PDB Compounds: (A:) Chitinase-3-like protein 1

SCOP Domain Sequences for d2dpea2:

Sequence; same for both SEQRES and ATOM records:

>d2dpea2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d2dpea2:

• d2dpea2 is new in SCOP 1.75
  
• d2dpea2 appears in SCOPe 2.01
  
• d2dpea2 appears in the current release, SCOPe 2.08