Lineage for d2dpea1 (2dpe A:1-239,A:308-362)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816611Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 816638Species Sheep (Ovis aries) [TaxId:9940] [109611] (12 PDB entries)
    Uniprot Q6TMG6
  8. 816640Domain d2dpea1: 2dpe A:1-239,A:308-362 [146553]
    Other proteins in same PDB: d2dpea2
    automatically matched to d1ljya1
    complexed with bma, man, nag

Details for d2dpea1

PDB Entry: 2dpe (more details), 2.07 Å

PDB Description: crystal structure of a secretory 40kda glycoprotein from sheep at 2.0a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOP Domain Sequences for d2dpea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpea1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

SCOP Domain Coordinates for d2dpea1:

Click to download the PDB-style file with coordinates for d2dpea1.
(The format of our PDB-style files is described here.)

Timeline for d2dpea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dpea2