Lineage for d2dofa1 (2dof A:888-959)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735563Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2735580Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 2735581Family a.159.2.1: FF domain [81699] (4 proteins)
  6. 2735589Protein Transcription elongation regulator 1 [158352] (1 species)
  7. 2735590Species Human (Homo sapiens) [TaxId:9606] [158353] (3 PDB entries)
    Uniprot O14776 651-719! Uniprot O14776 784-853! Uniprot O14776 888-959
  8. 2735591Domain d2dofa1: 2dof A:888-959 [146551]
    Other proteins in same PDB: d2dofa2, d2dofa3
    4th FF domain

Details for d2dofa1

PDB Entry: 2dof (more details)

PDB Description: solution structure of the fourth ff domain of human transcription factor ca150
PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2dofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dofa1 a.159.2.1 (A:888-959) Transcription elongation regulator 1 {Human (Homo sapiens) [TaxId: 9606]}
drereqhkreeaiqnfkallsdmvrssdvswsdtrrtlrkdhrwesgsllereekeklfn
ehiealtkkkre

SCOPe Domain Coordinates for d2dofa1:

Click to download the PDB-style file with coordinates for d2dofa1.
(The format of our PDB-style files is described here.)

Timeline for d2dofa1: