Class a: All alpha proteins [46456] (284 folds) |
Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.2: FF domain [81698] (1 family) |
Family a.159.2.1: FF domain [81699] (3 proteins) |
Protein Transcription elongation regulator 1 [158352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158353] (3 PDB entries) Uniprot O14776 651-719! Uniprot O14776 784-853! Uniprot O14776 888-959 |
Domain d2doda1: 2dod A:651-719 [146549] 1st FF domain |
PDB Entry: 2dod (more details)
SCOP Domain Sequences for d2doda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2doda1 a.159.2.1 (A:651-719) Transcription elongation regulator 1 {Human (Homo sapiens) [TaxId: 9606]} areraivplearmkqfkdmllergvsafstwekelhkivfdprylllnpkerkqvfdqyv ktraeeerr
Timeline for d2doda1: