| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.2: FF domain [81698] (1 family) ![]() |
| Family a.159.2.1: FF domain [81699] (4 proteins) |
| Protein Transcription elongation regulator 1 [158352] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158353] (3 PDB entries) Uniprot O14776 651-719! Uniprot O14776 784-853! Uniprot O14776 888-959 |
| Domain d2doda1: 2dod A:651-719 [146549] Other proteins in same PDB: d2doda2, d2doda3 1st FF domain |
PDB Entry: 2dod (more details)
SCOPe Domain Sequences for d2doda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2doda1 a.159.2.1 (A:651-719) Transcription elongation regulator 1 {Human (Homo sapiens) [TaxId: 9606]}
areraivplearmkqfkdmllergvsafstwekelhkivfdprylllnpkerkqvfdqyv
ktraeeerr
Timeline for d2doda1: