SCOPe 2.05: Domain d2doaa1: 2doa A:8-98

Lineage for d2doaa1 (2doa A:8-98)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.81: ELL N2 domain-like [158329] (2 proteins)
   PfamB PB026212; includes recent PDB entry 2e5n
   automatically mapped to Pfam PF10390

6. Protein RNA polymerase II elongation factor ELL [158330] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158331] (1 PDB entry)
   Uniprot P55199 197-297

8. Domain d2doaa1: 2doa A:8-98 [146548]

Details for d2doaa1

PDB Entry: 2doa

PDB Description: solution structure of the helical domain in human eleven-nineteen lysine-rich leukemia protein ell

PDB Compounds: (A:) RNA polymerase II elongation factor ELL

SCOPe Domain Sequences for d2doaa1:

Sequence; same for both SEQRES and ATOM records:

>d2doaa1 a.4.5.81 (A:8-98) RNA polymerase II elongation factor ELL {Human (Homo sapiens) [TaxId: 9606]}
vsqrpfrdrvlhllalrpyrkaelllrlqkdgltqadkdaldgllqqvanmsakdgtctl
qdcmykdvqkdwpgysegdqqllkrvlvrkl

Timeline for d2doaa1:

• d2doaa1 first appeared in SCOP 1.75
  
• d2doaa1 appears in SCOPe 2.04
  
• d2doaa1 appears in SCOPe 2.06
  
• d2doaa1 appears in the current release, SCOPe 2.08