Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.81: ELL N2 domain-like [158329] (2 proteins) PfamB PB026212; includes recent PDB entry 2e5n automatically mapped to Pfam PF10390 |
Protein RNA polymerase II elongation factor ELL [158330] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158331] (1 PDB entry) Uniprot P55199 197-297 |
Domain d2doaa1: 2doa A:6-98 [146548] Other proteins in same PDB: d2doaa2, d2doaa3 |
PDB Entry: 2doa (more details)
SCOPe Domain Sequences for d2doaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2doaa1 a.4.5.81 (A:6-98) RNA polymerase II elongation factor ELL {Human (Homo sapiens) [TaxId: 9606]} sgvsqrpfrdrvlhllalrpyrkaelllrlqkdgltqadkdaldgllqqvanmsakdgtc tlqdcmykdvqkdwpgysegdqqllkrvlvrkl
Timeline for d2doaa1: